|
Antibody HPA001609
|
|
Antibody HPA001666
|
|
Antibody HPA005812
|
|
Antibody HPA007185
|
|
Antibody CAB010894
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | SIGMA
| |
Product name |
HPA001609 | | HPA001666 | | HPA005812 | | HPA007185 | | R4528 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Rabbit | | Mouse | |
Clonality |
pAb | | pAb | | pAb | | pAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Not known | |
Released in version |
10 | | 5 | | 14 | | 14 | | 5 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Not known | |
Length (aa) |
126 | | 137 | | 137 | | 86 | | | |
Antigen sequence |
ETTDESLRSHFERWGMLTDCAVMRDPNTKRSRGFGFVTYATVEEVDAATN
ARPHKVDGKVVEPRRTVSREDYQRSGAHLTVKKIFVGGIKENTEKHQLRD
YFEQHGKMEVIEIMTEAVARKGALPL
| | VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREE
SGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGK
KRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
| | VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREE
SGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGK
KRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
| | GGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGY
GGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDS
| |
| |
Matching transcripts |
HNRNPA1-001 - ENSP00000448617 [80%] HNRNPA1-002 - ENSP00000341826 [80%] HNRNPA1-012 - ENSP00000447260 [80%] HNRNPA1-013 - ENSP00000447782 [80%] HNRNPA1-023 - ENSP00000333504 [80%]
| | HNRNPA1-001 - ENSP00000448617 [81%] HNRNPA1-002 - ENSP00000341826 [81%] HNRNPA1-012 - ENSP00000447260 [81%] HNRNPA1-013 - ENSP00000447782 [81%] HNRNPA1-023 - ENSP00000333504 [81%]
| | HNRNPA1-001 - ENSP00000448617 [81%] HNRNPA1-002 - ENSP00000341826 [81%] HNRNPA1-012 - ENSP00000447260 [81%] HNRNPA1-013 - ENSP00000447782 [81%] HNRNPA1-023 - ENSP00000333504 [81%]
| | HNRNPA1-002 - ENSP00000341826 [100%]
| | | |
Other gene match |
| | HNRNPA2B1 - ENSG00000122566 [100%] HNRNPA3 - ENSG00000170144 [81%]
| | HNRNPA2B1 - ENSG00000122566 [100%] HNRNPA3 - ENSG00000170144 [81%]
| | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | |
Description |
Immunohistochemical staining of human fallopian tube shows strong nuclear positivity. More information | | Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferous ducts. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | | | | | HIER pH6 | |
Antibody dilution |
1:400 | | 1:25 | | | | | | 1:600 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | | | | | Consistent with extensive gene/protein characterization data | |
RNA consistency |
Not done | | Not done | | | | | | Not done | |
Immunofluorescence
|
|
Image |
| | | | | | | | | |
Description |
Application not done for this antibody. | | Application not done for this antibody. | | Immunofluorescent staining of human cell line PC-3 shows positivity in nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli. More information | | Application not done for this antibody. | |
Antibody dilution |
| | | | 1:25 | | 1:4 | | | |
Validation IF |
| | | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | |
Western Blot
|
|
Image |
| | | | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
38.7, 34.2, 33.2, 29.4, 25.7 | | 39.6, 38.7, 37.4, 37, 36, 34.2, 33.2, 29.8, 29.4, 25.7 | | 39.6, 38.7, 37.4, 37, 36, 34.2, 33.2, 29.8, 29.4, 25.7 | | 38.7 | | 38.7, 34.2, 33.2, 29.4, 25.7, 19.5, 16.8, 16.5, 12.9 | |
Antibody dilution |
1:250 | | 1:250 | | 1:250 | | 1:250 | | 1:500 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | |
Protein array
|
|
Image |
| | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | |
Antibody dilution |
1:3000 | | 1:500 | | 1:3000 | | 1:500 | | | |
Validation PA |
Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | |
|