|
Antibody HPA030804
|
|
Antibody HPA030805
|
|
Antibody HPA031779
|
|
Antibody HPA031781
|
|
Antibody HPA036324
|
|
Antibody HPA036711
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
HPA030804 | | HPA030805 | | HPA031779 | | HPA031781 | | HPA036324 | | HPA036711 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Rabbit | | Rabbit | | Rabbit | |
Clonality |
pAb | | pAb | | pAb | | pAb | | pAb | | pAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | |
Released in version |
12 | | 12 | | 6 | | 12 | | 12 | | 12 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | |
Length (aa) |
82 | | 88 | | 91 | | 103 | | 68 | | 86 | |
Antigen sequence |
VMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEE
INDTMENDELFRTLASYKLIAPRYRWQRSKWG
| | VVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYG
GWIVDNCPIVKELWMALIKKGIIPDLVIYLSDTENNGK
| | YCPVTYKDGNQRYEALVPGSINYALEYHNRIYICENKEKLQKFLRSPLKY
WEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNA
| | CIDKLCITPQELLSRLGEFEQFCPVSLAESQELFDCSATDSLEFAAEFRG
HYYKMSSQEKLNKFLENPELYVPPLAPHPLPSADMIPKRLTLSELKSRFP
KCA
| | SEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIF
DRLLPAQIEKWKLKQKKK
| | ERKRHLGDTKHFCPVVLKENFILQPGNTEEAAKYREKIYYFSSAEAKEKF
LEHPEDYVAHEEPLKAPPLRICLVGPQGSGKTMCGR
| |
Matching transcripts |
AK9-006 - ENSP00000357944 [100%] AK9-007 - ENSP00000285397 [100%] AK9-201 - ENSP00000410186 [100%]
| | AK9-006 - ENSP00000357944 [100%] AK9-201 - ENSP00000410186 [100%]
| | AK9-003 - ENSP00000418771 [100%] AK9-004 - ENSP00000419758 [100%] AK9-201 - ENSP00000410186 [100%]
| | AK9-003 - ENSP00000418771 [100%] AK9-201 - ENSP00000410186 [100%] AK9-004 - ENSP00000419758 [90%]
| | AK9-001 - ENSP00000347431 [100%] AK9-002 - ENSP00000418670 [100%] AK9-201 - ENSP00000410186 [100%]
| | AK9-001 - ENSP00000347431 [100%] AK9-201 - ENSP00000410186 [100%]
| |
Other gene match |
| | | | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | | | |
Description |
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells. More information | | Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra. More information | | Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells. More information | | Immunohistochemical staining of human stomach, upper shows strong nuclear positivity in glandular cells. More information | | Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:100 | | 1:600 | | 1:150 | | 1:250 | | 1:100 | | 1:80 | |
Literature conformity |
No avaliable gene/protein characterization data | | No avaliable gene/protein characterization data | | No avaliable gene/protein characterization data | | No avaliable gene/protein characterization data | | No avaliable gene/protein characterization data | | No avaliable gene/protein characterization data | |
RNA consistency |
Mainly consistent with RNA expression data | | Mainly consistent with RNA expression data | | Mainly not consistent with RNA expression data | | Mainly consistent with RNA expression data | | Mainly not consistent with RNA expression data | | Mainly consistent with RNA expression data | |
Immunofluorescence
|
|
Image |
| | | | | | | | | | | |
Description |
Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & nucleus but excluded from the nucleoli. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & nucleus but excluded from the nucleoli. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:38 | | 1:185 | | | | | | | | | |
Validation IF |
Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | |
Target mass (kDa) |
221.4, 84.9, 48.5 | | 221.4, 84.9 | | 221.4, 87.2, 36.4 | | 221.4, 87.2, 36.4 | | 221.4, 39, 25.3 | | 221.4, 39 | |
Antibody dilution |
1:250 | | 1:250 | | 1:250 | | 1:250 | | 1:250 | | 1:250 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Non-supportive: Only bands not corresponding to the predicted size | |
Protein array
|
|
Image |
| | | | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | |
Antibody dilution |
1:3000 | | 1:3000 | | 1:3000 | | 1:3000 | | 1:3000 | | 1:500 | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | |
|