|
Antibody HPA000263
|
|
Antibody HPA011135
|
|
Antibody HPA011227
|
|
Antibody CAB010898
|
|
Antibody CAB047336
|
|
Antibody CAB047338
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | SIGMA
| | NCI-CPTC
| | NCI-CPTC
| |
Product name |
HPA000263 | | HPA011135 | | HPA011227 | | M7060 | | FSAI004:9E7 | | CPTC-MSN-3 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Mouse | | Mouse | | Mouse | |
Clonality |
pAb | | pAb | | pAb | | mAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Not known | | Protein A/G | | Protein A/G | |
Released in version |
4 | | 4 | | 4 | | 4 | | 14 | | 9 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Not known | | Recombinant protein | | Recombinant protein | |
Length (aa) |
122 | | 101 | | 110 | | | | | | | |
Antigen sequence |
SKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRL
FFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDR
LLPQRVLEQHKLTKEQWEERIQ
| | KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASR
DQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEK
T
| | AELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTT
EAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR
QIRQGNTKQR
| |
| |
| |
| |
Matching transcripts |
MSN-001 - ENSP00000353408 [85%]
| | MSN-001 - ENSP00000353408 [100%]
| | MSN-001 - ENSP00000353408 [100%]
| | | | | | | |
Other gene match |
RDX - ENSG00000137710 [100%]
| | | | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | | | |
Description |
Immunohistochemical staining of human tonsil shows positivity in the germinal centre. More information | | Immunohistochemical staining of human tonsil shows positivity in the germinal centre. More information | | Immunohistochemical staining of human tonsil shows positivity in the germinal centre. More information | | Immunohistochemical staining of human tonsil shows positivity in the germinal centre. More information | | Application not done for this antibody. | | Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells. More information | |
Retrieval method |
HIER pH9 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | | | HIER pH6 | |
Antibody dilution |
1:150 | | 1:750 | | 1:75 | | 1:80000 | | | | 1:60000 | |
Literature conformity |
Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | | | Partly consistent with extensive gene/protein characterization data | |
RNA consistency |
Mainly consistent with RNA expression data | | Not done | | Not done | | Not done | | | | Not done | |
Immunofluorescence
|
|
Image |
| | | | | | | | | | | |
Description |
Application not done for this antibody. | | Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane. More information | | Application not done for this antibody. | | Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane. More information | | Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm. More information | |
Antibody dilution |
| | 1:54 | | | | 1:2000 | | 1:2000 | | 1:2000 | |
Validation IF |
| | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | |
siRNA
|
|
Image |
| | | | | | | | | | | |
Description |
Application not done for this antibody. | | Signal downregulation > 25% by one siRNA. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
| | 1:55 | | | | | | | | | |
Validation siRNA |
| | Supportive: The siRNA validation is supportive. | | | | | | | | | |
Western blot - siRNA
|
|
Image |
| | | | | | | | | | | |
Description |
Application not done for this antibody. | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: siRNA 1 Lane 3: siRNA 2 Lane 4: Scrambled More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Target mass (kDa) |
| | 67.8 | | | | | | | | | |
Loading control |
| | Total protein image | | | | | | | | | |
Antibody dilution |
| | 1:119 | | | | | | | | | |
Validation WB-siRNA |
| | Supportive: Downregulation visible in one of two siRNA lanes | | | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | | | | | |
Description |
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5 Lane 2: RT4 Lane 3: U-251 MG Lane 4: A-431 Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Application not done for this antibody. | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
71, 68.6, 67.8, 23.4, 17.3 | | 67.8 | | 67.8 | | 67.8, 12.1 | | | | 67.8, 12.1 | |
Antibody dilution |
1:500 | | 1:250 | | 1:250 | | 1:500 | | | | 1:500 | |
Validation WB |
Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | |
Protein array
|
|
Image |
| | | | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:2000 | | 1:3000 | | 1:500 | | | | | | | |
Validation PA |
Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | | | | | | |
|