|
Antibody HPA001338
|
|
Antibody HPA001383
|
|
Antibody CAB000043
|
|
Antibody CAB020416
|
|
Antibody CAB062555
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | DakoCytomation
| | Novocastra
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
HPA001338 | | HPA001383 | | A0485 | | NCL-CBE-356 | | AMAb90627 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Mouse | | Mouse | |
Clonality |
pAb | | pAb | | msAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity | | Not known | | Protein A/G | |
Released in version |
14 | | 1 | | 1 | | 5 | | 12 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Synthetic peptide | | Recombinant protein | | Recombinant protein | |
Length (aa) |
123 | | 124 | | | | | | | |
Antigen sequence |
LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAE
EYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAP
RSPLAPSEGAGSDVFDGDGAPHR
| | LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLER
PKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDN
LYYWDQDPPERGAPPSTFKGTPTA
| |
| |
| |
| |
Matching transcripts |
ERBB2-001 - ENSP00000462438 [96%] ERBB2-004 - ENSP00000404047 [96%] ERBB2-008 - ENSP00000269571 [96%] ERBB2-201 - ENSP00000385185 [96%] ERBB2-202 - ENSP00000446466 [96%]
| | ERBB2-001 - ENSP00000462438 [100%] ERBB2-004 - ENSP00000404047 [100%] ERBB2-008 - ENSP00000269571 [100%] ERBB2-201 - ENSP00000385185 [100%] ERBB2-202 - ENSP00000446466 [100%]
| | | | | | | |
Other gene match |
| | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | |
Description |
Application not done for this antibody. | | Immunohistochemical staining of human urinary bladder shows moderate membranous and cytoplasmic positivity in urothelial cells. More information | | Immunohistochemical staining of human rectum shows weak cytoplasmic positivity in glandular cells. More information | | Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells. More information | | Immunohistochemical staining of human urinary bladder shows positivity in urothelial cells. More information | |
Retrieval method |
| | HIER pH6 | | HIER pH9 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
| | 1:100 | | 1:1500 | | 1:50 | | 1:80 | |
Literature conformity |
| | Consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Partly consistent with extensive gene/protein characterization data | |
RNA consistency |
| | Mainly consistent with RNA expression data | | Mainly consistent with RNA expression data | | Mainly consistent with RNA expression data | | Mainly consistent with RNA expression data | |
Immunofluorescence
|
|
Image |
| | | | | | | | | |
Description |
Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane. More information | | Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & plasma membrane. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:67 | | 1:75 | | | | | | | |
Validation IF |
Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8 Lane 2: RT4 Lane 3: U-251 MG Lane 4: A-431 Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
137.9, 136.5, 134.9, 107.6 | | 137.9, 136.5, 134.9, 107.6 | | 137.9, 136.5, 134.9, 117.1, 107.6, 66.5, 27.7, 19.4, 18.1, 15.6, 11.5 | | 137.9, 136.5, 134.9, 117.1, 107.6, 66.5, 27.7, 19.4, 18.1, 15.6, 11.5 | | 137.9, 136.5, 134.9, 117.1, 107.6, 66.5, 27.7, 19.4, 18.1, 15.6, 11.5 | |
Antibody dilution |
1:250 | | 1:250 | | 1:500 | | 1:500 | | 1:500 | |
Validation WB |
Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data | | Non-supportive: Only bands not corresponding to the predicted size | | Uncertain: No bands detected | |
Protein array
|
|
Image |
| | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:6000 | | 1:3000 | | | | | | | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | | | | | |
|