ATP8B3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041992

 

Antibody HPA043582

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041992 HPA043582 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

78 61 

Antigen sequence

RARKYEWRPEGPTSMGSLGQREDLQDEDRNSAFTWKVQANNRAYNGQFKE
KVILCWQRKKYKTNVIRTAKYNFYSFLP
 
NLKFRQALMVTHKELATIKKMASFQGTVTCEAPNSRMHHFVGCLEWNDKK
YSLDIGNLLLR
 

Matching transcripts

ATP8B3-001 - ENSP00000445204 [100%]
ATP8B3-002 - ENSP00000311336 [100%]
ATP8B3-004 - ENSP00000445883 [100%]
ATP8B3-005 - ENSP00000437115 [100%]
ATP8B3-009 - ENSP00000465027 [100%]
 ATP8B3-001 - ENSP00000445204 [100%]
ATP8B3-002 - ENSP00000311336 [100%]
ATP8B3-005 - ENSP00000437115 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lymph node shows strong positivity in a subset of non-germinal center cells.
More information
 Immunohistochemical staining of human lymph node shows strong positivity in a subset of non-germinal center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:20 

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data 

RNA consistency

Not consistent with RNA expression data Not consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:66 1:58 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

146.8, 143.7, 64, 33.3, 22.9 146.8, 143.7, 64 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATP8B3-001
 
ATP8B3-002
 
ATP8B3-004
 
ATP8B3-005
 
ATP8B3-009