|
Antibody HPA004812
|
|
Antibody CAB000087
|
|
Antibody CAB028364
|
|
Antibody CAB072855
|
|
Antibody CAB072856
|
|
Antibody CAB072857
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Zymed
| | ECM Biosciences
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| |
Product name |
HPA004812 | | 13-1700 | | CM1681 | | AMAb90862 | | AMAb90863 | | AMAb90865 | |
Host species |
Rabbit | | Mouse | | Mouse | | Mouse | | Mouse | | Mouse | |
Clonality |
pAb | | mAb | | mAb | | mAb | | mAb | | mAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Not known | | Protein A/G | | Protein A/G | | Protein A/G | | Protein A/G | |
Released in version |
3 | | 1 | | 6 | | 14 | | 14 | | 14 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Not known | | Recombinant protein | | Recombinant protein | | Recombinant protein | | Recombinant protein | |
Length (aa) |
125 | | | | | | | | | | | |
Antigen sequence |
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIID
ADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKIN
LKLMDNQNKDQVTTLEVSVCDCEGA
| |
| |
| |
| |
| |
| |
Matching transcripts |
CDH1-001 - ENSP00000261769 [100%] CDH1-004 - ENSP00000414946 [100%] CDH1-201 - ENSP00000481063 [100%]
| | | | | | | | | | | |
Other gene match |
| | | | | | | | | | | |
ANTIBODY VALIDATION
|
|
Immunohistochemistry
|
|
Image |
| | | | | | | | | | | |
Description |
Immunohistochemical staining of human kidney shows membranous positivity in distal tubules. More information | | Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells. More information | | Immunohistochemical staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells. More information | | Immunohistochemical staining of human stomach shows membranous positivity in glandular cells. More information | | Immunohistochemical staining of human esophagus shows strong membranous positivity in squamous epithelial cells. More information | | Immunohistochemical staining of human stomach shows membranous positivity in glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:300 | | 1:10000 | | 1:450 | | 1:750 | | 1:1000 | | 1:850 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | |
RNA consistency |
Consistent with RNA expression data | | Consistent with RNA expression data | | Consistent with RNA expression data | | Consistent with RNA expression data | | Consistent with RNA expression data | | Consistent with RNA expression data | |
Immunofluorescence
|
|
Image |
| | | | | | | | | | | |
Description |
Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & focal adhesion sites. More information | | Application not done for this antibody. | | Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & the Golgi apparatus. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:24 | | | | 1:112 | | | | | | | |
Validation IF |
Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
100, 97.5, 90.9 | | 100, 97.5, 90.9, 71.4, 71.3 | | 100, 97.5, 90.9, 71.4, 71.3 | | 100, 97.5, 90.9, 71.4, 71.3 | | 100, 97.5, 90.9, 71.4, 71.3 | | 100, 97.5, 90.9, 71.4, 71.3 | |
Antibody dilution |
1:250 | | 1:500 | | 1:500 | | 1:500 | | 1:500 | | 1:500 | |
Validation WB |
Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | |
Protein array
|
|
Image |
| | | | | | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:3000 | | | | | | | | | | | |
Validation PA |
Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | | | | | | | | | |
|