C9orf129

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA071515

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA071515 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

42 

Antigen sequence

GATKYTIYWGFRATDHHVQGRDSQARGTAAHWHGGHVCSPNV
 

Matching transcripts

C9orf129-001 - ENSP00000364568 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in mitochondria.
More information
 

Antibody dilution

1:4 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

20.7 

Antibody dilution

1:80 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
C9orf129-001