CMKLR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047865

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA047865 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

51 

Antigen sequence

QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERET
G
 

Matching transcripts

CMKLR1-001 - ENSP00000311733 [100%]
CMKLR1-002 - ENSP00000449716 [100%]
CMKLR1-005 - ENSP00000447579 [100%]
CMKLR1-201 - ENSP00000401293 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:30 

Literature conformity

Not consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.3, 42.0 

Antibody dilution

1:280 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2200 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CMKLR1-001
 
CMKLR1-002
 
CMKLR1-005
 
CMKLR1-201