POLR2K

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA063185

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA063185 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

48 

Antigen sequence

DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
 

Matching transcripts

POLR2K-001 - ENSP00000342889 [100%]
POLR2K-002 - ENSP00000430106 [96%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line SH-SY5Y shows positivity in nucleus & cytoplasm.
More information
 

Antibody dilution

1:130 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

Target too small/large to be analyzed with the present setup 

Target mass (kDa)

8.0, 7.0 

Antibody dilution

 

Validation WB

Target too small/large to be analyzed with the present setup 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
POLR2K-001
 
POLR2K-002