SUCLA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039435

 

Antibody HPA039536

 

Antibody HPA061528

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039435 HPA039536 HPA061528 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 14 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

85 85 95 

Antigen sequence

FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKI
LACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP
 
ATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMEL
LQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIK
 
PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIE
INPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD
 

Matching transcripts

SUCLA2-001 - ENSP00000367923 [100%]
 SUCLA2-001 - ENSP00000367923 [100%]
 SUCLA2-001 - ENSP00000367923 [100%]
SUCLA2-009 - ENSP00000415091 [100%]
SUCLA2-010 - ENSP00000392771 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. Application not done for this antibody. 

Retrieval method

HIER pH6   

Antibody dilution

1:400   

Literature conformity

Consistent with extensive gene/protein characterization data   

RNA consistency

Mainly consistent with RNA expression data   

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line HEK 293 shows positivity in mitochondria.
More information
 

Antibody dilution

 1:65 1:37 

Validation IF

 Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

50.3 50.3 50.3, 32.0, 17.1 

Antibody dilution

1:250 1:250 1:120 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:1350 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SUCLA2-001
 
SUCLA2-009
 
SUCLA2-010