DICER1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000694

 

Antibody CAB068185

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000694 AMAb90737 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

194  

Antigen sequence

PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKET
PFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETF
AEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAE
KRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
 
 

Matching transcripts

DICER1-001 - ENSP00000343745 [100%]
DICER1-004 - ENSP00000437256 [100%]
DICER1-006 - ENSP00000435681 [100%]
DICER1-016 - ENSP00000444719 [100%]
DICER1-201 - ENSP00000376783 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in distal tubules and in cells in glomeruli.
More information
 Immunohistochemical staining of human appendix shows cytoplasmic positivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:1000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:200 

Validation IF

 Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

218.7, 208.4 218.7, 208.4, 92.7, 45.0, 7.7 

Antibody dilution

1:250 1:1000 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
DICER1-001
 
DICER1-004
 
DICER1-006
 
DICER1-016
 
DICER1-201